PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009606904.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family WRKY
Protein Properties Length: 590aa    MW: 64960.8 Da    PI: 7.0503
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009606904.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY96.51.9e-30219276260
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                     +DgynWrKYGqK v+g+ef+rsYY+Ct+++C +kk+vers+ d+++++++Y g+H+h+k
  XP_009606904.1 219 EDGYNWRKYGQKLVRGNEFTRSYYKCTYPNCLAKKQVERSH-DGHITDVHYIGKHEHPK 276
                     8****************************************.***************85 PP

2WRKY103.31.3e-32395453159
                     ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     ++Dg++WrKYGqK vkg+++prsYYrC+ agCpvkk+ver+++dpk+v++tYeg+H+h+
  XP_009606904.1 395 VNDGHRWRKYGQKYVKGNPNPRSYYRCSIAGCPVKKHVERASHDPKMVVTTYEGQHDHN 453
                     58********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081121.436213277IPR003657WRKY domain
SuperFamilySSF1182902.22E-24215276IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.0E-26215276IPR003657WRKY domain
SMARTSM007746.3E-34218276IPR003657WRKY domain
PfamPF031064.5E-23219275IPR003657WRKY domain
Gene3DG3DSA:2.20.25.807.7E-34381453IPR003657WRKY domain
SuperFamilySSF1182901.26E-28387454IPR003657WRKY domain
PROSITE profilePS5081133.66390455IPR003657WRKY domain
SMARTSM007744.4E-37395454IPR003657WRKY domain
PfamPF031062.7E-25396452IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 590 aa     Download sequence    Send to blast
MGTPREEATN EVSSENLQRK PDPDPATNNP ELKEKGRCEP ISADVVSGEL QKRLSPAADA  60
QASKSNQEET THPSTCQDVS SNVSQSNQED ISLSKEQQYQ SENVRQKQGL KSEGDASVCS  120
QLSILPKVSD AKSCGSESGV IEKVVSPLSG KSSDSSDQIQ SQSMEVVVSQ SDHQRVTYPI  180
RPEKTLDKLQ PRRNPDTSGH GLPSDRGMTL FRLPEKPLED GYNWRKYGQK LVRGNEFTRS  240
YYKCTYPNCL AKKQVERSHD GHITDVHYIG KHEHPKTPSG PQTSPGLVAP LQMRQPDIPV  300
LTTSEEAEGE KSTTRETCES SKPSEAPLAL DIVSAGAGMQ VTPLKPHKLE NEVDKNSGPD  360
SKRQKKDIAK DDTPPIKSHS EPRHIVQTMS EVDIVNDGHR WRKYGQKYVK GNPNPRSYYR  420
CSIAGCPVKK HVERASHDPK MVVTTYEGQH DHNMSWFRTL SQITAAPDLS LTGISGESRL  480
ESGETKHIGE SISELGENKH VGKSRIESGE NKHVGESRIE SGETKRVGQS ISESGETKHV  540
RASISESGET KHVGESRIES GKNKHVGQSR SESGENKHVN LDMVVHIGAN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A1e-31209454275WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0962980.0AF096298.1 Nicotiana tabacum DNA-binding protein 1 (WRKY1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009606904.10.0PREDICTED: probable WRKY transcription factor 20 isoform X2
RefseqXP_009606903.10.0PREDICTED: probable WRKY transcription factor 20 isoform X2
TrEMBLQ9ZPL70.0Q9ZPL7_TOBAC; DNA-binding protein 1 (Fragment)
STRINGPGSC0003DMT4000741570.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.14e-71WRKY family protein